PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_06749
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family TCP
Protein Properties Length: 334aa    MW: 37454.2 Da    PI: 9.3512
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_06749genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP138.36.3e-43712083133
         TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa..sec...eaesssssasnsssg......ka 90 
                  +kdrhski T++g+RdRR+Rls+++a++fFdLqd LGfdk+skt++WLl+++k+aikel+g+ s+    s++   ++ s +s ++    g       a
  PEQU_06749  71 IRKDRHSKINTAQGPRDRRMRLSLDVARKFFDLQDLLGFDKASKTVQWLLTMSKAAIKELVGSASKCTvvSSSegeKDISTVSDNK----GktksaiLA 165
                 79*************************************************************44444221122222222222222....234557744 PP

         TCP  91 aksaakskksqksaasalnlakesrakarararertrekmrik 133
                 ++++++ k+++++  +   +a+esr++arararert ek++++
  PEQU_06749 166 SEFEKNAKPKKRPIVQSKLVARESRERARARARERTLEKKMMR 208
                 4444444444455554578888*****************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.3E-4172207IPR005333Transcription factor, TCP
PROSITE profilePS5136936.62672130IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.936187204IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MFSQANELYY NAEKQDISSS FFFHFSPPTF HHDNLHDILI PAAAAAPAPV AQERTSSSGA  60
AQPITGRRRQ IRKDRHSKIN TAQGPRDRRM RLSLDVARKF FDLQDLLGFD KASKTVQWLL  120
TMSKAAIKEL VGSASKCTVV SSSEGEKDIS TVSDNKGKTK SAILASEFEK NAKPKKRPIV  180
QSKLVARESR ERARARARER TLEKKMMRCC RPEDGSKSNQ QANILKSIPL GSFLQEEYSS  240
SHDLKSSLDF VAEMEEHCST SPIMYAKEHD HNGSSSAVVF DCNQQTAVSL FQEQWDHRSA  300
FPSNYIDEKV LFGEALLQTS YGRGISTPSM FDHV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189199RERARARARER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010916819.14e-51PREDICTED: transcription factor TEOSINTE BRANCHED 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP72533651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.11e-28TCP domain protein 12